| Catalog# |
C058 |
| Source |
E.coli |
| Description |
Recombinant Human C-X-C Motif Chemokine Ligand 14/CXCL14 produced in E. coli is a single non-glycosylated polypeptide chain containing 77 amino acids with a molecular mass of 9.4 kD. |
| Names |
C-X-C Motif Chemokine 14, Chemokine BRAKm MIP-2G, Small-Inducible Cytokine B14, CXCL14, MIP2G, NJAC, SCYB14 |
| Accession # |
O95715 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 1M NaCl, pH 8.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
ED50 is 1.0-10.0 ng/ml as determined by the ability of Recombinant CXCL14 to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWY NAWNEKRRVYEE
|
| Background |
Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues. |
