Catalog# |
CG20 |
Source |
HEK293 |
Description |
Recombinant Mouse C-X-C Motif Chemokine 16/CXCL16 is produced with our HEK293 expression system. The target protein is expressed with sequence (Asn27Trp201) of Mouse CXCL16 fused with a 6His tag at the C-terminus. |
Names |
C-X-C Motif Chemokine 16, Scavenger Receptor for Phosphatidylserine and Oxidized Low Density Lipoprotein, SR-PSOX, Small-Inducible Cytokine B16, Transmembrane Chemokine CXCL16, Cxcl16, Srpsox |
Accession # |
Q8BSU2 |
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
Amino Acid Sequence |
NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELV DCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEH TQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH
|
Background |
C-X-C Motif Chemokine 16 (CXCL16) belongs to the intercrine alpha (chemokine CxC) family. CXCL16 is a single-pass type I membrane protein, which consists of 246 amino acids. CXCL16 induces a strong chemotatic response and calcium mobilization. CXCL16 acts as a scavenger receptor on macrophages, which specially binds to oxidized low density lipoprotein. CXCL16 may be involved in pathophysiology such as atherogenesis. Soluble CXCL16 may play an important role in liver metastases through the induction of epithelial-mesenchymal transition. |