| Catalog# |
CF14 |
| Source |
E.coli |
| Description |
Recombinant Human C-X-C Motif Chemokine 5/CXCL5 is produced with our E. coli expression system. The target protein is expressed with sequence (Leu44-Asn114) of Human CXCL5. |
| Names |
C-X-C Motif Chemokine 5, ENA-78 (1-78), Epithelial-Derived Neutrophil-Activating Protein 78, Neutrophil-Activating Peptide ENA-78, Small-Inducible Cytokine B5, ENA-78 (8-78), ENA-78 (9-78), CXCL5, ENA78, SCYB5 |
| Accession # |
P42830 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 6.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKIL DGGNKEN
|
| Background |
C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78). In vitro, ENA-78(8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers. |