| Catalog# |
CI83 |
| Source |
Human cells |
| Description |
Recombinant Human Platelet basic protein is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ser35-Asp128) of Human PPBP fused with a polyhistidine tag at the C-terminus. |
| Names |
Platelet Basic Protein, PBP, C-X-C Motif Chemokine 7, Leukocyte-Derived Growth Factor, LDGF, Macrophage-Derived Growth Factor, MDGF Small-Inducible Cytokine B7, PPBP, CTAP3, CXCL7, SCYB7, TGB1, THBGB1 |
| Accession # |
P02775 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mMHAc-Nac,150mM NaCl, pH4.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
SSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLK DGRKICLDPDAPRIKKIVQKKLAGDESADVDHHHHHH
|
| Background |
Human Chemokine (C-X-C motif) Ligand 7 (CXCL7), also known as neutrophil activating peptide 2 (NAP-2), is a member of the CXC chemokines containing an ELR domain (Glu-Leu-Arg tripeptide motif). Similar to other ELR domain containing CXC chemokines, such as IL-8 and the GRO proteins, CXCL7 binds CXCR2, chemoattracts and activates neutrophils. CXCL7, Connective Tissue Activating Protein III (CTAPIII) and βthrombogulin (βTG), are proteolytically processed carboxylterminal fragments of platelet basic protein (PBP) which is found in the alphagranules of human platelets. Although CTAPIII, βTG, and PBP represent amino-terminal extended variants of NAP2 and possess the same CXC chemokine domains, these proteins do not exhibit CXCL7/NAP2 activity. CXCL7 induces cell migration through the G-protein-linked receptor CXCR-2. |
