| Catalog# |
CC97 |
| Source |
HEK293 |
| Description |
Recombinant Human CXCL8/IL-8 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ser99) of Human CXCL8/IL-8 fused with a polyhistidine tag at the C-terminus. |
| Names |
Interleukin-8, IL-8, C-X-C Motif Chemokine 8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, Monocyte-Derived Neutrophil Chemotactic Factor, MDNCF, Monocyte-Derived Neutrophil-Activating Peptide, MONAP, Neutrophil-Activating Protein 1, NAP-1, Protei |
| Accession # |
P10145 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWV QRVVEKFLKRAENSVDHHHHHH*
|
| Background |
Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states. |
