| Catalog# |
C627 |
| Source |
HEK293 |
| Description |
Recombinant Human Cyclophilin B/CYPB is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Asp34-Glu216) of Human CYPB fused with a polyhistidine tag at the C-terminus. |
| Names |
Peptidyl-Prolyl Cis-Trans Isomerase B, PPIase B, CYP-S1, Cyclophilin B, Rotamase B, S-Cyclophilin, SCYLP, PPIB, CYPB |
| Accession # |
P23284 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
DEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIK DFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLD GKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKEVDHHHHHH
|
| Background |
Cyclophilin B is a member of the cyclophilin-type PPIase family and PPIase B subfamily which contains one PPIase cyclophilin-type domain. Cyclophilin B is a cyclosporin A binding protein that can be secreted in response to inflammatory stimuli. Cyclophilin B interaction with prolactin potentiated prolactin-induced proliferation, cell growth, and the nuclear retrotransport of prolactin. The intranuclear prolactin/cyclophilin B complex acts as a transcriptional inducer by interacting directly with Stat5, resulting in the removal of the Stat-repressor protein inhibitor of activated Stat 3 (PIAS3), thereby enhancing Stat5 DNA-binding activity and prolactin-induced, Stat5-mediated gene expression. Defects in PPIB are the cause of osteogenesis imperfecta type 9 (OI9). |
