| Catalog# |
CA20 |
| Source |
HEK293 |
| Description |
Recombinant Human Cystatin-8/CST8 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys22-Ala142) of Human CST8 fused with a 6His tag at the C-terminus. |
| Names |
Cystatin-8, Cystatin-Related Epididymal Spermatogenic Protein, CST8, CRES |
| Accession # |
O60676 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
KDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLI DVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDAVDHHHHHH
|
| Background |
Cystatin-8 is a secreted protein which belongs to the cystatin family. The cystatin superfamily contains multiple cystatin-like sequences. Cystatin-8 localizes to the cystatin locus and encodes a protein similar to type 2 cystatins. Cystatin-8 performs a specialized role during sperm development and maturation. Cystatin-8 exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. In addition, Cystatin-8 performs a specialized role during sperm development and maturation. |
