| Catalog# |
C087 |
| Source |
E.coli |
| Description |
Recombinant Human Cystatin A is produced with our E. coli expression system. The target protein is expressed with sequence (Ile2-Phe98) of Human Cystatin A. |
| Names |
Cystatin-A, Cystatin-AS, Stefin-A, CSTA, STF1, STFA |
| Accession # |
P01040 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRA GDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
|
| Background |
Human Cystatin A (CSTA) is a member of family 1 of the cystatin superfamily, which is characterized by lacking of disulphide bonds an carbohydrates. Cystatin A is an intracellular inhibitor regulating the activities of cysteine proteases of the papain family such as Cathepsins B, H and L. Cystatin A is also implicated in a number of disease states. Due to altered proteolytic state in cancer progression, Cystatin A may play a role in the proteolytic pathways. |
