| Catalog# |
CE75 |
| Source |
E. coli |
| Description |
Recombinant Human Cystatin C/CST3 is produced by our E. coli expression system. The target protein is expressed with sequence (Gly26-‐Ala146) of Human CST3 fused with a polyhistidine tag at the N-terminus. |
| Names |
Cystatin-C,Cystatin-3,Gamma-trace,CST3 |
| Accession # |
P01034 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMENLYFQGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKA SNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIY AVPWQGTMTLSKSTCQDA
|
| Background |
Cystatin c is a 14kDa member of the Cystatin superfamily of cysteine protease inhibitors. Most cell types secrete Cystatin C. Cystatin C inhibits cathepsins, and thereby may function as a tumor suppressor by inhibiting cathepsin mediated tumor cell invasion. In addition, this tumor suppressor function can also be attributed to Cystatin C's ability to antagonize TGF-β1 signaling. Cystatin C may also modulate antigen presentation through its ability to inhibit cathepsins. Cystatin C is also a biomarker for kidney dysfunction. |
