| Catalog# |
CD44 |
| Source |
Human Cells |
| Description |
Recombinant Mouse Cystatin E/M/CST6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu29Val149) of Mouse CST6 fused with a polyhistidine tag at the C-terminus. |
| Names |
Cystatin E/M, Cst6. |
| Accession # |
Q9D1B1 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM MES,150mM NaCl,pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
ELRSRRTGERQNLSPTDPRVQKAAQAAVASYNMGSDSLYYFRDTKVIDAKYQLVAGIKYYLTLDI ESTECRKTRVSGEHMDLTTCPLAAGGQQEKLRCNFELLEVPWKNTTQLLKHDCVQVVDHHHHHH*
|
| Background |
Mouse CST6 is a member of the family 2 of the cystatin superfamily. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. CST6 is expressed in heart, liver and kidney. In addition to its function as a cysteine protease inhibitor, CST6 also serves as a target for cross-linking by transglutaminases. Accordingly, CST6 was suggested to be involved in barrier formation and maintenance. Furthermore, studies have revealed that CST6 is frequently epigenetically inactivated during breast carcinogenesis, and thus be regarded as a candidate of tumour suppressor gene. |
