| Catalog# |
CD20 |
| Source |
Human Cells |
| Description |
Recombinant Mouse Cystatin F/CST7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala19-Gln144) of Mouse Cystatin F fused with a polyhistidine tag at the C-terminus. |
| Names |
Cystatin-F, Cystatin-like Metastasis-Associated Protein, Leukocystatin, CMAP, Cystatin-7, Cst7, |
| Accession # |
O89098 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVK GLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQVDHH HHHH
|
| Background |
Mouse Cystatin F belongs to cystatin superfamily, which encompasses proteins that contain multiple cystatin-like sequences. It has been shown that Cystatin F is selectively expressed by hematopoietic cells and may be a biomarker for both liver metastasis and inflammatory lung disorders. Mouse Cystatin F inhibits papain and cathepsin L but with affinities lower than other cystatins. It may play a role in immune regulation through inhibition of a unique target in the hematopoietic system. |
