| Catalog# |
C462 |
| Source |
HEK293 |
| Description |
Recombinant Human Cystatin SN is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Trp21-Ser141) of Human CST1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1, CST1 |
| Accession # |
P01037 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFF DVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQESVDHHHHHH
|
| Background |
Cystatin-SN is a member of family 2 of the Cystatin superfamily and a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. Together with Cystatins S and SA, it is produced by the salivary gland and secreted largely in the submandibular/sublingual saliva. Cystatin-SN inhibits members of the Papain family including Cathepsins B, C, H and L. |
