| Catalog# |
CF80 |
| Source |
E.coli |
| Description |
Recombinant Human Cytochrome C/CYCS is produced with our E. coli expression system. The target protein is expressed with sequence (Gly2-Glu105) of Human CYCS fused with a 6His tag at the C-terminus. |
| Names |
Cytochrome C, CYCS, CYC |
| Accession # |
P99999 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.15M NaCl, 20% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTL MEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNELEHHHHHH
|
| Background |
Cytochrome C (CYCS) is a small heme protein that belongs to the cytochrome c family. It is found loosely associated with the inner membrane of the mitochondrion. Cytochrome C is a highly soluble protein that functions as a central component of the electron transport chain in mitochondria. CYCS transfers electrons between Complexes III (Coenzyme Q - Cyt C reductase) and IV (Cyt C oxidase). CYCS plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of Cytochrome C to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases. |
