| Catalog# |
CB68 |
| Source |
Human Cells |
| Description |
Recombinant Human Dermatopontin/DPT is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln19Val201) of Human Dermatopontin fused with a FC-6His tag at the C-terminus. |
| Names |
Dermatopontin, also known as Tyrosine-rich acidic matrix protein, TRAMP and DPT, |
| Accession # |
Q07507 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS，pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQS LGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIE YPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVVDDIEGRMDEPK SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
|
| Background |
Dermatopontin, also known as Tyrosine-rich acidic matrix protein, TRAMP and DPT, is a secreted protein which belongs to the dermatopontin family. DPT is expressed in various tissues, such as fibroblasts, heart, skeletal muscle, brain and pancreas. It seems to mediate adhesion by cell surface integrin binding. DPT may serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. DPT can enhance TGFB1 activity through interaction with decorin. In addition, DPT accelerates collagen fibril formation, stabilizes collagen fibrils against low-temperature dissociation and inhibits cell proliferation. |
