| Catalog# |
CE91 |
| Source |
E.coli |
| Description |
Recombinant Human DNA Fragmentation Factor Subunit Alpha/DFFA is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Thr331) of Human DFFA fused with a 6His tag at the N-terminus. |
| Names |
DNA Fragmentation Factor Subunit Alpha, DNA Fragmentation Factor 45 kDa Subunit, DFF-45, Inhibitor of CAD, ICAD, DFFA, DFF1, DFF45, H13 |
| Accession # |
O00273 |
| Formulation |
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSK ACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQES FDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTL QQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHS LRSISASKASPPGDLQNPKRARQDPT
|
| Background |
DNA Fragmentation Factor Subunit Alpha (DFFA). DFFA exists as a heterodimer (DFF) with DFFB. DFF is activated once DFFA is cleaved by Caspase-3. The cleaved fragments of DFFA detach from DFFB (the active component of DFF), which in turn triggers DNA fragmentation as well as chromatin condensation during apoptosis. A reduced level of DFFA detected in ovarian endometriosis may be a part of an apoptosis-resistant mechanism enhancing the disease progression. |
