| Catalog# |
C158 |
| Source |
E. coli |
| Description |
Recombinant Phi32 DNA Polymerase is produced with our E. coli expression system. The target protein is expressed with sequence of Phi32 DNA Polymerase. |
| Names |
Type I DNA Polymerase |
| Accession # |
B0FIN6 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 100mM KCl, 1mM DTT, 0.1mM EDTA, 0.5% Tween 20, 0.5% NP-40, 50% Glycerol, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MVKKKKKVFAFDIESNALYDDITKVWCIYIFDVETGERWGYRPHQIEDGIRKLTEADVLVGHNII DFDLPALKKMYPSLINYHFNVFDTLCLSRYLKPDRIGDSPEYPKGDPRRGPRGHGLKQWGEFLGE LKGDYGEQEEAWDAFTEDMFTYCEQDVNLTVKVYLFLCELTGFDPYDPPLYWKM
|
| Background |
Phi32 DNA Polymerase, also named Type I DNA polymerase, is a number of DNA polymerase. DNA polymerases are essential for DNA replication, and usually function in pairs while copying one double-stranded DNA molecule into two double-stranded DNAs in a process termed semiconservative DNA replication. DNA polymerases also play key roles in other processes within cells, including DNA repair, genetic recombination, reverse transcription, and the generation of antibody diversity via the specialized DNA polymerase, terminal deoxynucleotidyl transferase. |
