| Catalog# |
CC73 |
| Source |
Human Cells |
| Description |
Recombinant Human DPP10/DPRP3/DPL2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu56-Glu796) of Human DPP10 fused with a polyhistidine tag at the C-terminus. |
| Names |
Inactive dipeptidyl peptidase 10, also called Dipeptidyl peptidase IV-related protein 3, Dipeptidyl peptidase X, Dipeptidyl peptidase-like protein 2, is a single-pass type II membrane protein which belongs to the peptidase S9B family, DPPIV subfamily. |
| Accession # |
Q8N608 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 3X PBS.
Please aliquot the reconstituted solutionৣ惨薠樈י䪠଼櫸י빠ା拠ñɋd |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 5 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
LTPDELTNSSETRLSLEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIKLNIETNATTLLLENT TFVTFKASRHSVSPDLKYVLLAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVLQYAAW GVQGQQLIYIFENNIYYQPDIKSSSLRLTSSGKEEIIFNGIADWLYEEELLHSHIAHWWSPDGER LAFLMINDSLVPTMVIPRFTGALYPKGKQYPYPKAGQMNPTIKLYVVNLYGPTHTLELMPPDSFK SREYYITMVKWVSNTKTVVRWLNRAQNISILTVCETTTGACSKKYEMTSDTWLSQQNEEPVFSRD GSKFFMTVPVKQGGRGEFHHIAMFLIQSKSEQITVRHLTSGNWEVIKILAYDETTQKIYFLSTES SPRGRQLYSASTEGLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPA KYFILESNSMLKEAILKKKIGKPEIKILHIDDYELPLQLSLPKDFMDRNQYALLLIMDEEPGGQL VTDKFHIDWDSVLIDMDNVIVARFDGRGSGFQGLKILQEIHRRLGSVEVKDQITAVKFLLKLPYI DSKRLSIFGKGYGGYIASMILKSDEKLFKCGSVVAPITDLKLYASAFSERYLGMPSKEESTYQAA SVLHNVHGLKEENILIIHGTADTKVHFQHSAELIKHLIKAGVNYTMQVYPDEGHNVSEKSKYHLY STILKFFSDCLKEEISVLPQEPEEDEVDHHHHHH
|
| Background |
Inactive dipeptidyl peptidase 10, also called Dipeptidyl peptidase IV-related protein 3, Dipeptidyl peptidase X, Dipeptidyl peptidase-like protein 2, is a single-pass type II membrane protein which belongs to the peptidase S9B family, DPPIV subfamily. It is expressed in brain, pancreas, spinal cord and adrenal glands, and may form oligomers. This protein has no dipeptidyl aminopeptidase activity. It may modulate cell surface expression and activity of the potassium channels KCND1 and KCND2. Genetic variations in DPP10 are associated with susceptibility to asthma. |
