| Catalog# |
CF33 |
| Source |
E.coli |
| Description |
Recombinant Human Deoxyuridine 5'-Triphosphate Nucleotidohydrolase Mitochondrial/DUT is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asn164) of Human Dutpase. |
| Names |
Deoxyuridine 5'-Triphosphate Nucleotidohydrolase Mitochondrial, dUTPase, dUTP Pyrophosphatase, DUT |
| Accession # |
P33316-2 |
| Formulation |
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAV VKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIA QLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
|
| Background |
Deoxyuridine 5'-Triphosphate Nucleotidohydrolase Mitochondrial (dUTPase) belongs to the dUTPase family. dUTPase exits as a homotrimer and is involved in nucleotide metabolism. dUTPase produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA. The dUTPase increase in PCR product yield, length and fidelity enables further down-stream applications. These effects make dUTPase useful in PCR fidelity and yield-sensitive applications. dUTPase is specific for dUTP and is critical for the fidelity of DNA replication and repair. |
