| Catalog# |
C029 |
| Source |
E.coli |
| Description |
Recombinant Human EGF, Recombinant Human Epidermal Growth Factor is produced by our E. coli expression system. The target protein is expressed with sequence (N971-R1023) of Human EGF. |
| Names |
Recombinant Human EGF, Pro-Epidermal Growth Factor, EGF, Epidermal Growth Factor, Urogastrone |
| Accession # |
P01133 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 7.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
ED50 is less than 2 ng/ml as calculated by the dose-dependent proliferation of murine BALB/c 3T3 cells. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
|
| Background |
Recombinant Human EGF: Epidermal growth factor (EGF) is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha), which is a competitor for EGF receptor sites. EGF is a small 53 amino acid residue long protein that contains three disulfide bridges |
