| Catalog# |
C220 |
| Source |
E.coli |
| Description |
Recombinant Human Eukaryotic Translation Initiation Factor 1B/EIF1B is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Phe113) of Human EIF1B fused with a His tag at the N-terminus. |
| Names |
Eukaryotic Translation Initiation Factor 1b, eIF1b, Protein Translation Factor SUI1 Homolog GC20, EIF1B |
| Accession # |
O60739 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 500mM NaCl, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLT TVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKV HGF
|
| Background |
Eukaryotic Translation Initiation Factor 1B (EIF1B) is an element of a complex involved in recognition of the initiator codon during the scanning process. Translation is also initiated by the function of EIF1B in regulating the activity of ribosomal subunits 43S, 48S and 40S. EIF1B enables 43S ribosomal complexes to distinguish between cognate and near-cognate initiation codons, perceiving the nucleotide content of initiation codons. |
