| Catalog# |
C465 |
| Source |
HEK293 |
| Description |
Recombinant Human Ephrin-B2 produced by transfected human cells is a secreted protein with sequence (Ile28-Ala229) of Human EFNB2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Ephrin-B2, EPH-Related Receptor Tyrosine Kinase Ligand 5, LERK-5, HTK Ligand, HTK-L, EFNB2, EPLG5, HTKL, LERK5 |
| Accession # |
P52799 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIK KENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRA MKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILG SEVALFAVDHHHHHH
|
| Background |
Ephrin-B2 is a type I transmembrane protein and belongs the Ephrin family. It binds to the receptor tyrosine kinases, such as EPHA4, EPHB4 and EPHA3. Ephrin-B2 has been implicated in mediating developmental events, especially in the nervous system, erythropoiesis and tumour metastasis. Ligation of Ephrin-B2 with complementary EphB receptors on adjacent cells results in a combination of forward (EphB receptors) and reverse (Ephrin-B2) signalling, which is central to tissue development and remodelling functions. In addition, Ephrin-B2 may play a role in constraining the orientation of longitudinally projecting axons. |
