| Catalog# |
C134 |
| Source |
E.coli |
| Description |
Recombinant Human Fatty Acid-Binding Protein 2/FABP2 is produced with our E. coli expression system. The target protein is expressed with sequence (Ala2-Asp132) of Human FABP2 fused with HIS tags at both the N-terminus and C-terminus. |
| Names |
Fatty Acid-Binding Protein Intestinal, Fatty Acid-Binding Protein 2, Intestinal-Type Fatty Acid-Binding Protein, I-FABP, FABP2, FABPI |
| Accession # |
P12104 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEG NKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREII GDELVQTYVYEGVEAKRIFKKDLEHHHHHH
|
| Background |
Fatty Acid-Binding Protein 2 (FABP2) is a cytoplasm protein that belongs to the Fatty-acid binding protein (FABP) family of calycin superfamily. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP2 is expressed in the small intestine and at much lower levels in the large intestine, the highest expression levels in the jejunum. FABP2 binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis and may also help maintain energy homeostasis by functioning as a lipid sensor. |
