| Catalog# |
C137 |
| Source |
E.coli |
| Description |
Recombinant Human Fatty Acid-Binding Protein 5/FABP5 is produced with our E. coli expression system. The target protein is expressed with sequence (Ala2-Glu135) of Human FABP5. |
| Names |
Fatty Acid-Binding Protein Epidermal, Epidermal-Type Fatty Acid-Binding Protein, E-FABP, Fatty Acid-Binding Protein 5, Psoriasis-Associated Fatty Acid-Binding Protein Homolog, PA-FABP, FABP5 |
| Accession # |
Q01469 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCII TCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRK LKDGKLVVECVMNNVTCTRIYEKVE
|
| Background |
Fatty acid-binding protein 5 (FABP5) is a cytoplasm protein that belongs to the fatty-acid binding protein (FABP) family of calycin superfamily. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP5 can be expressed in keratinocytes, and is highly expressed in psoriatic skin. FABP5 has been shown to be involved in keratinocyte differentiation. FABP5 has high specificity for fatty acids, the highest affinity for C18 chain length. FABP5 can decrease the chain length or introduce double bonds to reduce the affinity. |
