| Catalog# |
CA53 |
| Source |
Human Cells |
| Description |
Recombinant Human High Affinity Immunoglobulin ε Receptor Subunit α/FCER1A is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val26-Gln205) of Human FCER1A fused with a polyhistidine tag at the C-terminus. |
| Names |
High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha, Fc-Epsilon RI-Alpha, FcERI, IgE Fc Receptor Subunit Alpha, FCER1A, FCE1A |
| Accession # |
P12319 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGE YKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYW YENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQVDHHHHHH
|
| Background |
High Affinity Immunoglobulin ε Receptor Subunit α (FCER1A) is a single-pass type I membrane protein that contains two Ig-like domains. FCER1A is a tetramer consisting of an α chain, a β chain, and two disulfide linked γ chains. FCER1A is a high affinity receptor, binds to the Fc region of immunoglobulins ε and plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory. Immediate hypersensitivity responses are characteristic of disorders such as hay fever and asthma. FCER1A with binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. |
