| Catalog# |
C345 |
| Source |
HEK293 |
| Description |
Recombinant Human Fetuin-B is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Cys16-Pro382) of Human FETUB fused with a polyhistidine tag at the C-terminus. |
| Names |
Fetuin-B, 16G2, Fetuin-Like Protein IRL685, Gugu, FETUB |
| Accession # |
Q9UGM5 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
CGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGS LFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLRPVSKK KIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYL IKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKP TNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLD ISFLFLEPMEEKLVVLPFPKEKARTAECPGPAQNASPLVLPPVDHHHHHH
|
| Background |
Fetuin-B is a member of the Fetuin family that is part of the Cystatin superfamily of Cysteine Protease inhibitors. It is reported that Fetuin-B is highly expressed in liver tissue, in tongue and placenta tissues. Fetuin-B is a paralogue of Fetuin-A. Fetuin-A and Fetuin-B display similarities and differences in their characteristics, however, they share only 20% amino acid sequence identity. The amounts of Fetuin-B in human serum, unlike Fetuin-A, vary with gender and are higher in females than in males. Fetuin-B is an inhibitor of basic calcium phosphate precipitation but is less active than Fetuin-A. Fetuin-B expression is decreased in Fetuin-A deficient knock-out mice. The expression of Fetuin-B has been shown to be regulated by FXR (Farnesoid X Receptor), a nuclear receptor activated by bile acids. Evidence has shown that overexpression of Fetuin-B in skin squamous carcinoma cells suppresses tumor growth in nude mice. The function of Fetuin B is still not fully characterized. |
