| Catalog# |
C043 |
| Source |
E.coli |
| Description |
Recombinant Mouse Fibroblast Growth Factor Acidic is produced with our E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of Mouse FGF-A. |
| Names |
Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Heparin-Binding Growth Factor 1, HBGF-1, Fgf1, Fgf-1, Fgfa |
| Accession # |
P61148 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 500mM NaCl, pH 6.6 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
ED50 is less than 0.5 ng/ml as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of Heparin.
Specific Activity of 2.0 x 106 IU/mg. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYL AMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAI LFLPLPVSSD
|
| Background |
FGF acidic is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which is produced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells of neuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. FGF-acidic is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors. |