| Catalog# |
C996 |
| Source |
Human Cells |
| Description |
Recombinant Human Fibroblast Growth Factor 17/FGF-17 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr23-Thr216) of Human FGF17. |
| Names |
Fibroblast Growth Factor 17, FGF-17, FGF17 |
| Accession # |
O60258 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKL IVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFM AFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
|
| Background |
Fibroblast Growth Factor 17 (FGF17) is a member of the heparin-binding growth factors family that is prominently expressed in the cerebellum and cortex. Proteins of this family possess broad mitogenic and cell survival activities and they are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF17 plays an important role in the regulation of embryonic development and it acts as signaling molecule in the induction and patterning of the embryonic brain. In addition, FGF17 stimulates the proliferation and activation of cells that express FGF receptors. |
