| Catalog# |
C132 |
| Source |
E.coli |
| Description |
Recombinant Human Esterase D is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ala282) of Human Esterase D. |
| Names |
S-Formylglutathione Hydrolase, FGH, Esterase D, Methylumbelliferyl-Acetate Deacetylase, ESD |
| Accession # |
P10768 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 10% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKS GYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQ LINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTD QSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEDYDH SYYFIATFITDHIRHHAKYLNALEHHHHHH
|
| Background |
Human Esterase D is a serine hydrolase that is involved in the detoxification of formaldehyde. Esterase D plays a part in a variety of substrates, including O-acetylated sialic acids, which may involves in the recycling of sialic acids. Esterase D can be used as a genetic marker for retinoblastoma and Wilson’s disease. |
| References |
Koyama K,et al.Identification of Bioactivating Enzymes Involved in the Hydrolysis of Laninamivir Octanoate, a Long-Acting Neuraminidase Inhibitor, in Human Pulmonary Tissue
PMID:24682756
http://www.ncbi.nlm.nih.gov/pubmed/24682756 |
