| Catalog# |
C269 |
| Source |
E.coli |
| Description |
Recombinant Human γ-Aminobutyric Acid Receptor-Associated Protein-Like 1/GABARAPL1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Lys117) of Human GABARAPL1 fused with a His tag at the N-terminus. |
| Names |
Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1, Early Estrogen-Regulated Protein, GABA(A) Receptor-Associated Protein-Like 1, Glandular Epithelial Cell Protein 1, GEC-1, GABARAPL1, GEC1 |
| Accession # |
Q9H0R8 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLD KRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYS DESVYGK
|
| Background |
Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1 (GABARAPL1) is a cytoplasmic protein that belongs to the MAP1 LC3 family. GABARAPL1 is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle. It can interact with GABRG2, OPRK1 and β-Tubulin. GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. |
