| Catalog# |
CB28 |
| Source |
HEK293 |
| Description |
Recombinant Human N-acetylgalactosamine kinase/GALK2/GK2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ala458) of Human GALK2 fused with a polyhistidine tag at the C-terminus. |
| Names |
N-acetylgalactosamine kinase, also known as GalNAc kinase, Galactokinase 2, GALK2 and GK2, is a member of the GHMP kinase family and GalK subfamily. |
| Accession # |
Q01415 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MATESPATRRVQVAEHPRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQ DVLIAVEPVKTYALQLANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGM NCLVDGNIPPSSGLSSSSALVCCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISF LAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSL QWDKVLRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLGISLEELRTQILSPNTQDVLI FKLYQRAKHVYSEAARVLQFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELDQLVDICR KFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVL LEAVDHHHHHH
|
| Background |
GALK2 acts as a galactokinase when galactose is present at high concentrations. GALK2 may be involved in a salvage pathway for the reutilization of free GalNAc derived from the degradation of complex carbohydrates. GALK2 has been reported to participate in pathways , such as Amino sugar and nucleotide sugar metabolism, Galactose metabolism and Metabolic pathways. |
