| Catalog# |
C002 |
| Source |
E.coli |
| Description |
Recombinant Human G-CSF (Granulocyte Colony-Stimulating Factor) produced in E. coli is a single non-glycosylated polypeptide chain containing 175 amino acids with a molecular mass of 18.8 kD. |
| Names |
Recombinant Human G-CSF, Granulocyte Colony-Stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33, GCSF |
| Accession # |
P09919-2 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
ED50 is less than 0.1 ng/ml as calculated by the dose-dependent proliferation of murine NFS-60 indicator cells.
Specific Activity of 6.0 x 107 IU/ mg. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.03 ng/μg (0.03 IEU/μg) as determined by LAL test. |
| Amino Acid Sequence |
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSC PSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPA LQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
|
| Background |
Recombinant Human G-CSF: Granulocyte-Colony-Stimulating Factor is 20 kD glycoprotein containing internal disulfide bonds. It induces the survival, proliferation, and differentiation of neutrophilic granulocyte precursor cells and it functionally activates mature blood neutrophils. Among the family of colony-stimulating factors, G-CSF is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of G-CSF can be induced by bacterial endotoxins, TNF, Interleukin-1, and GM-CSF. Prostaglandin E2 inhibits the synthesis of G-CSF. In epithelial, endothelial, and fibroblastic cells secretion of G-CSF is induced by Interleukin-17. |
