| Catalog# |
CA68 |
| Source |
HEK293 |
| Description |
Recombinant Human Growth/Differentiation Factor 3/GDF3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln25-Gly364) of Human GDF3 fused with a polyhistidine tag at the C-terminus. |
| Names |
Growth/Differentiation Factor 3, GDF-3, GDF3 |
| Accession # |
Q9NR23 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
QEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREAAATTGVSRDLCYVKELGVRGNVLRFLPDQ GFFLYPKKISQASSCLQKLLYFNLSAIKEREQLTLAQLGLDLGPNSYYNLGPELELALFLVQEPH VWGQTTPKPGKMFVLRSVPWPQGAVHFNLLDVAKDWNDNPRKNFGLFLEILVKEDRDSRVNFQPE DTCARLRCSLHASLLVVTLNPDQCHPSRKRRAAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIA PKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVI LRHYEDMVVDECGCGVDHHHHHH
|
| Background |
Growth/Differentiation Factor 3 (GDF3) is a secreted protein that belongs to the transforming growth factor β (TGF-β) superfamily. GDF3 is expressed in ossifying bone during embryonic development and in the brain, thymus, spleen, bone marrow, and adipose tissue of adults. GDF3 has some intrinsic activity and also modulate other TGF-β superfamily members. It may also inhibit other TGF-β superfamily members, regulating the balance between different modes of TGF-β signaling. GDF3 also negatively and positively control differentiation of embryonic stem cells in mouse and human. This molecule plays a role in mesoderm and definitive endoderm formation during the pre-gastrulation stages of development. Defects in GDF3 are the cause of many disorders, such as Klippel-Feil syndrome type 3 (KFS3), microphthalmia isolated with coloboma type 6 (MCOPCB6), microphthalmia isolated type 7 (MCOP7). |