| Catalog# |
C226 |
| Source |
E.coli |
| Description |
Recombinant Human GDNF (Glial Cell Line-Derived Neurotrophic Factor) is produced by our E. coli expression system. The target protein is expressed with sequence (Ser78-Ile211) of Human GDNF. |
| Names |
Recombinant Human GDNF, Glial Cell Line-Derived Neurotrophic Factor, hGDNF, Astrocyte-Derived Trophic Factor, ATF, GDNF |
| Accession # |
P39905 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.25 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIF RYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKR CGCI
|
| Background |
Recombinant Human GDNF: Glial Cell Line-Derived Neurotrophic Factor is a disulfide-linked homodimeric glycoprotein that belongs to the TGF-β superfamily. It has been shown to promote the survival of various neuronal subpopulations in both the central as well as the peripheral nervous systems at different stages of their development. Human GDNF cDNA encodes a 211 amino acid residue prepropeptide that is processed to yield a dimeric protein. Mature human GDNF was predicted to contain two 134 amino acid residue subunits. Cells known to express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells, neurons, pinealocytes and skeletal muscle cells. Mutations in this gene may be associated with Hirschsprung disease. |