Catalog# |
C471 |
Source |
HEK293 |
Description |
Recombinant Human GDNF Family Receptor α-1/GFRA1 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Asp25-Lys429) of Human GFRA1 fused with a polyhistidine tag at the C-terminus. |
Names |
GDNF Family Receptor Alpha-1, GDNF Receptor Alpha-1, GDNFR-Alpha-1, GFR-Alpha-1, RET Ligand 1, TGF-Beta-Related Neurotrophic Factor Receptor 1, GFRA1, GDNFRA, RETL1, TRNR1 |
Accession # |
P56159 |
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
Amino Acid Sequence |
DRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRC KRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISVEHIPKGNNCLDAAK ACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTER RRQTIVPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAY SGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVW QPAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGN YEKEGLGASSHITTKVDHHHHHH
|
Background |
Glial Cell Line-Derived Neurotrophic Factor Family Receptor α-1 (GDNFRα1) is a glycosylphosphatidylinositol (GPI) linked cell surface protein belonging to GDNF-family receptor α subtype which consists of at least four members. GFRα1and GFRα2 are the cognate co-receptor for the neurotrophic factor neurturin mediating the NRTN-induced autophosphorylation and activation of the RET tyrosine kinase receptor. Soluble GFRαs released enzymatically from the cell surface by phosphatidylinositol phospholipase C, as well as recombinantly produced soluble GFRα1, can also bind with high affinity to GDNF and trigger the activation of Ret tyrosine kinase. Human GFRα1 shares 93% amino acid identity with mouse GFRα1.The expression of the various GFRαs are differentially regulated in the central and peripheral nervous system, suggesting complementary roles for the GFRαs in mediating the activities of the GDNF family of neurotrophic factors. |