| Catalog# |
CH08 |
| Source |
E.coli |
| Description |
Recombinant Human Histatin-3/HTN3 is produced with our E. coli expression system. The target protein is expressed with sequence (Asp20-Asn51) of Human HTN3 fused with a GST tag at the N-terminus. |
| Names |
Histatin-3, Basic histidine-rich protein, Histidine-rich protein 3, PB, HTN3. |
| Accession # |
P15516 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM NaCl,pH 8.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDSHAKRHHGYKRKFHEKHHSHRGYR SNYLYDN*
|
| Background |
HTN3 belongs to the histatin/statherin family. Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities. Post-translational proteolytic processing results in many histatins: e.g., histatins 4-6 are derived from histatin 3 by proteolysis. Histatins 1 and 3 are primary products of HIS1and HIS2 alleles, respectively. Histatins are believed to have important non-immunological, anti-microbial function in the oral cavity. |
