| Catalog# |
C284 |
| Source |
E.coli |
| Description |
Recombinant Human Heat Shock Factor Protein 2/HSF2 is produced by our E. coli expression system. The target protein is expressed with sequence (Ser411-Ser536) of Human HSF2 fused with a 6His tag at the N-terminus. |
| Names |
Heat Shock Factor Protein 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2, HSF2, HSTF2 |
| Accession # |
Q03933 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFL DGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYL CELAPAPLDSDMPLLDS
|
| Background |
Heat Shock Factor Protein 2 (HSF2) belongs to the HSF family of transcription factors that bind specifically to the heat-shock promoter element and activate transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked. HSF2 is widely expressed in many cells and tissues. HSF2 is located on Cytoplasmic during normal growth. But when it is activited, HSF2 moves to the nucleus. |
