| Catalog# |
CF61 |
| Source |
E.coli |
| Description |
Recombinant Human Insulin-Like Growth Factor II/IGF2 is produced with our E. coli expression system. The target protein is expressed with sequence (Ala25-Glu91) of Human IGF2. |
| Names |
Insulin-Like Growth Factor II, IGF-II, Somatomedin-A, IGF2, PP1446 |
| Accession # |
P01344 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 5mM Hac, pH ~3.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MFPAMPLSSLFVNAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCD LALLETYCATPAKSE
|
| Background |
Insulin-Like Growth Factor II (IGF2) belongs to the insulin family of polypeptide growth factors that is involved in development and growth. Members of this family are structurally homologous to proinsulin, and share higher sequence identity. IGF2 is expressed only from the paternally inherited allele and believed to be secreted by the liver and to circulate in the blood. IGF2 possess growth-promoting activity and can stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. IGF2 is influenced by placental lactogen and may play a role in fetal development. |
