| Catalog# |
C347 |
| Source |
HEK293 |
| Description |
Recombinant Human Insulin-Like Growth Factor-Binding Protein 4/IGFBP-4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (D22-E258) of Human IGFBP4 fused with a polyhistidine tag at the C-terminus. |
| Names |
Insulin-Like Growth Factor-Binding Protein 4, IBP-4, IGF-Binding Protein 4, IGFBP-4, IGFBP4, IBP4 |
| Accession # |
P22692 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGV EKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRST SGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCH PALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFREVDHHHHHH
|
| Background |
IGFBP-4, whose full name is insulin-like growth factor-binding protein 4, is induced by forskolin and N6, O2’dibutyryl sdenosine 3’, or 5’-cyclic monophosphate. It contains IGFBP N-terminal domain and thyroglobulin type-1 domain, and can bind IGF2. The IGF-binding proteins can prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. |
