| Catalog# |
CA41 |
| Source |
HEK293 |
| Description |
Recombinant Human Insulin-Like Growth Factor-Binding Protein 5/IGFBP-5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu21-Glu272) of Human IGFBP5 fused with a 6His tag at the C-terminus. |
| Names |
Insulin-Like Growth Factor-Binding Protein 5, IBP-5, IGF-Binding Protein 5, IGFBP-5, IGFBP5, IBP5 |
| Accession # |
P24593 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
LGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVYTERCAQGLRCLPRQD EEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAE AVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMVPRAVY LPNCDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVEVDHHHHHH
|
| Background |
Insulin-Like Growth Factor-Binding Protein 5 (IGFBP-5) is a secreted protein that belongs to the insulin-like growth factor (IGF) binding proteins superfamily. Members of this family prolong the half-life of the IGFs. They have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. IGFBP-5 contains one IGFBP N-terminal domain and one thyroglobulin type-1 domain. IGFBP-5 is expressed by fibroblasts, myoblasts and Osteosarcoma. It is also present at lower levels in liver, kidney, and brain. |
