| Catalog# |
C027 |
| Source |
E. coli |
| Description |
Recombinant Human Interleukin-10/IL-10 produced in E. coli is a single non-glycosylated polypeptide chain containing 160 amino acids with a molecular mass of 18,648 Daltons. |
| Names |
Interleukin-10, IL-10, Cytokine Synthesis Inhibitory Factor, CSIF, IL10 |
| Accession # |
P22301 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, pH 7.3 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
ED50 is less than 2 ng/ml as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells.
Specific Activity of 1.5 x 106 IU/mg. |
| Purity |
Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQA LSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFN KLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
|
