| Catalog# |
C006 |
| Source |
P. pastoris |
| Description |
Recombinant Human Interleukin-11/IL-11 is produced in P. pastoris by recombinant DNA technology. The protein has a molecular mass of approximately 19,000 Daltons and is non-glycosylated. The protein is 177 amino acids in length and differs from the 178 amino acid length of native IL-11 by lacking the amino-terminal praline residue. |
| Names |
Interleukin-11, IL-11, Adipogenesis Inhibitory Factor, AGIF, Oprelvekin, IL11 |
| Accession # |
P20809 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 2% Glycine, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
ED50 is less than 0.2 ng/ml as determined by the dose-dependent stimulation of murine 7TD1 proliferation.
Specific Activity of 8.0 x 106 IU/ mg. |
| Purity |
Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. |
| Amino Acid Sequence |
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALG ALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQ PPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
|
| Background |
Interleukin 11 (IL-11) is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. IL-11 is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors. |
| References |
Temozolomide resistance in glioblastoma occurs by miRNA-9-targeted PTCH1, independent of sonic hedgehog level.
|
