| Catalog# |
CD72 |
| Source |
Human Cells |
| Description |
Recombinant Human Interleukin-18/IL-18 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Tyr37-Asp193) of Human IL-18 fused with a polyhistidine tag at the C-terminus. |
| Names |
Interleukin-18, Iboctadekin, Interferon gamma-inducing factor, IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma,GIF, IL-18, IL-1g, IL1F4, MGC12320 |
| Accession # |
Q14116 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS，pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTIS VKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKE RDLFKLILKKEDELGDRSIMFTVQNEDVDHHHHHH*
|
| Background |
Interleukin-18 is a secreted protein and it belongs to the IL-1 family. IL-18 is a proinflammatory cytokine and produced by macrophages and other cells. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity. After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-γ (IFN-γ) or type II interferon that plays an important role in activating the macrophages or other cells. |
