Catalog# |
CG93 |
Source |
E.coli |
Description |
Recombinant Human Interleukin-1 beta/IL1B is produced with our E. coli expression system. The target protein is expressed with sequence (Ala117-Ser269) of Human IL1B. |
Names |
Interleukin-1 beta, Catabolin, IL1F2, IL1B. |
Accession # |
P01584 |
Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
Amino Acid Sequence |
MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAEN MPVFLGGTKGGQDITDFTMQFVSS*
|
Background |
IL1B is a 269 amino acids protein which belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells. |