| Catalog# |
C073 |
| Source |
E.coli |
| Description |
Recombinant Human Interleukin-37/IL-37 is produced with our E. coli expression system. The target protein is expressed with sequence (Lys27-Asp192) of Human IL-37. |
| Names |
Interleukin-37, FIL1 Zeta, IL-1X, Interleukin-1 Family Member 7, IL-1F7, Interleukin-1 Homolog 4, IL-1H, IL-1H4, Interleukin-1 Zeta, IL-1 Zeta, Interleukin-1-Related Protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1 |
| Accession # |
Q9NZH6.2 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKG EFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSC NCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
|
| Background |
Human Interleukin family 1 Member 7 (IL1F7) is a member of the Interleukin 1 cytokine family. Five alternatively spliced transcript variants encoding distinct isoforms have been reported with distinct expression profiles. The longest IL1F7 transcript, referred to as IL1F7b or IL1F7 isoform 1, encodes a 218 amino acid residues proprotein containing a 45 amino acid propeptide, which is cleaved to generate mature protein. IL1F7b binds to IL18 Rα with low affinity but does not exert any IL18 agonistic or antagonistic effects. IL1F7b also binds interleukin 18 binding protein (IL-18BP), an inhibitory binding protein of interleukin 18 (IL-18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL-18. |
