| Catalog# |
C952 |
| Source |
Human Cells |
| Description |
Recombinant Human Interleukin-22 Receptor Subunit α-2/IL22RA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr22-Pro231) of Human IL22RA2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Interleukin-22 Receptor Subunit Alpha-2, IL-22 Receptor Subunit Alpha-2, IL-22R-Alpha-2, IL-22RA2, Cytokine Receptor Class-II Member 10, Cytokine Receptor Family 2 Member 10, CRF2-10, Cytokine Receptor Family Type 2 Soluble 1, CRF2-S1, Interleukin-22-Binding Protein, IL-22BP, IL22BP, ZcytoR16, IL22RA2 |
| Accession # |
Q969J5-2 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 5X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 7 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSC DLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNL PYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPML DRRSQRSEERCVEIPVDHHHHHH
|
| Background |
Interleukin-22 Receptor Subunit α-2 (IL22RA2) belongs to the type II cytokine receptor family. IL22RA2 is a secreted protein and contains three fibronectin type-III domains. IL22RA2 is widely expressed in many tissues. IL22RA2 functions as an IL22 antagonist and may be important in the regulation of inflammatory response. Three alternatively spliced transcript variants encoding distinct isoforms have been described. |
