| Catalog# |
CF63 |
| Source |
E.coli |
| Description |
Recombinant Human Interleukin-3/IL3 is produced with our E. coli expression system. The target protein is expressed with sequence (Ala20-Phe152) of Human IL3 fused with a 6His tag at the N-terminus. |
| Names |
Interleukin-3, IL-3, Hematopoietic Growth Factor, Mast Cell Growth Factor, MCGF, Multipotential Colony-Stimulating Factor, P-Cell-Stimulating Factor, IL3 |
| Accession # |
P08700 |
| Formulation |
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MNHKVHHHHHHMAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNL RRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTL ENAQAQQTTLSLAIF
|
| Background |
Interleukin-3 (IL-3) is a potent growth promoting cytokine. IL-3 can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its biological function through binding to specific cell surface receptors. The amino acid sequences of this protein among different species share relatively low identity and its activity is highly species-specific. IL-3 has also been shown to possess neurotrophic activity, and is thought to be associated with neurologic disorders. |
