| Catalog# |
CD90 |
| Source |
Human Cells |
| Description |
Recombinant Human Interleukin-3/IL-3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala20-Phe152) of Human IL-3 fused with a polyhistidine tag at the C-terminus. |
| Names |
Interleukin-3, IL-3, Hematopoietic Growth Factor, Mast Cell Growth Factor, MCGF, Multipotential Colony-Stimulating Factor, P-Cell-Stimulating Factor, IL3 |
| Accession # |
P08700 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS，pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MTSTLPFSPQVSTPRSKFKRISSVLSIEFAATMSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWV NCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILK NLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFVDHHHHHH
|
| Background |
Interleukin-3 (IL-3) is a potent growth promoting cytokine. IL-3 can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its biological function through binding to specific cell surface receptors. The amino acid sequences of this protein among different species share relatively low identity and its activity is highly species-specific. IL-3 has also been shown to possess neurotrophic activity, and is thought to be associated with neurologic disorders. |
