| Catalog# |
C496 |
| Source |
HEK293 |
| Description |
Recombinant Human Oncostatin-M-Specific Receptor Subunit β/OSMRB produced by transfected human cells is a secreted protein with sequence (Glu28-Ser739) of Human OSMRB fused with a polyhistidine tag at the C-terminus. |
| Names |
Oncostatin-M-Specific Receptor Subunit Beta, Interleukin-31 Receptor Subunit Beta, IL-31 Receptor Subunit Beta, IL-31R Subunit Beta, IL-31R-Beta, IL-31RB, OSMR, OSMRB |
| Accession # |
Q99650 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
ERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWN QVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKL VEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNV SEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKL CTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMT WKVHSIRNNFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSE WSGQNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSSSE LHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTEGGFSLSW KPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFRIYGLSTKRIACL LEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYHVYLKSKARQCHPRFEK AVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTSAGEGPSATFTKVTTPDEHSSVDH HHHHH
|
| Background |
Oncostatin-M-Specific Receptor Subunit β (OSMRβ) is a 150 - 180 kDa member of the IL-6 receptor family. OSMRβ associates with gp130 to form the type II OSM receptor, the receptor is responsive to OSM. Gp130 subunit is shared by other IL-6 family cytokine receptors, and OSMRβ associates with gp130-like receptor (GPL) to form a receptor complex responsive to IL-31. The human OSMRβ cDNA encodes a 979 amino acid (aa) precursor, the precursor includes a 27 aa signal sequence, a 712 aa extracellular domain (ECD), a 22 aatransmembrane segment, and a 218 aa cytoplasmic domain. The ECD contains one partial and one complete hematopoietin domain, an Ig-like domain, and three Fibronectin type-III domains. |
