| Catalog# |
C009 |
| Source |
E. coli |
| Description |
Recombinant Human Interleukin-6/IL-6 is produced by E. coli transformed with a plasmid contains sequence (Pro29-Met212) of Human IL-6 fused with a polyhistidine tag at the C-terminus. |
| Names |
Interleukin-6, IL-6, B-Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon Beta-2, IFN-Beta-2, IL6, IFNB2 |
| Accession # |
P05231 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 5.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
Recombinant IL-6 is fully biologically active when compared to standards.
ED50 is less than 0.1 ng/ml as determined by the dose-dependent stimulation of human TF-1 cells.
Specific Activity of 5.0 x 107 IU/mg. |
| Purity |
Greater than 98% as determined by RP-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLP KMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKA KNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
| Background |
Cytokines of the IL6/GCSF/MGF family are glycoproteins of about 170 to 180 amino acid residues that contain four conserved cysteine residues involved in two disulfide bonds. They have a compact, globular fold (similar to other interleukins), stabilized by the 2 disulfide bonds. One half of the structure is dominated by a 4 alpha-helix bundle with a left-handed twist; the helices are anti-parallel, with 2 overhand connections, which fall into a 2-stranded anti-parallel beta-sheet. The fourth alpha helix is important to the biological activity of the molecule. Interleukin-6 (IL-6) is an important proinflammatory and immunoregulatory cytokine expressed by various cells. Interleukin-6 has been shown to inhibit the growth of early stage and to promote the proliferation of advanced stage melanoma cells in vitro. |
| References |
Han K,et al.Identification of a promising PI3K inhibitor for the treatment of multiple myeloma through the structural optimization
PMID:24428908
http://www.ncbi.nlm.nih.gov/pubmed/24428908 |
