| Catalog# |
CG39 |
| Source |
E.coli |
| Description |
Recombinant Mouse Interleukin-6/Il6 is produced with our E. coli expression system. The target protein is expressed with sequence (Phe25Thr211) of Mouse Il6. |
| Names |
Interleukin-6, IL-6, B-Cell Hybridoma Growth Factor, Interleukin HP-1, Il6, Il-6 |
| Accession # |
P08505 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALAENNL KLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIF NQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT
|
| Background |
Interleukin-6 (IL-6) is a pro-inflammatory cytokine that also has an important role in immunity. Mouse IL-6 appears to be directly involved in the responses that occur after infection and injury and may prove to be as important as IL-1 in regulating the acute phase response. Mouse IL-6 is reported to be produced by fibroblasts, activated T cells, activated monocytes or macrophages, and endothelial cells. It acts upon a variety of cells, including fibroblasts, myeloid progenitor cells, T cells, B cells and hepatocytes. IL-6 has a wide variety of biological functions: it plays an essential role in the final differentiation of B-cells into Ig-secreting cells, it induces myeloma and plasmacytoma growth, nerve cells differentiation in hepatocytes, and acute phase reactants. |
